PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02077.1.g00060.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 901aa    MW: 96604.2 Da    PI: 6.8137
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02077.1.g00060.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.48e-21221276156
                                   TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   +++ +++t++q++eLe++F+++++p+ ++r++L++ lgL+  qVk+WFqN+R+++k
  Zpz_sc02077.1.g00060.1.am.mk 221 KKRYHRHTQHQIQELEAFFKQCPHPDDKQRKQLSQDLGLEPLQVKFWFQNKRTQMK 276
                                   688999***********************************************999 PP

2START202.51.7e-634046291206
                                   HHHHHHHHHHHHHHHHC-TT-EEEE......EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGG CS
                         START   1 elaeeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddke 70 
                                   ela +a++elv++a+++ep+Wv  +      e + ++e+ ++f+++ +      ++ea+r+s+vv+m++  lve l+d + 
  Zpz_sc02077.1.g00060.1.am.mk 404 ELAVAAMEELVQMAQLGEPLWVPTVidgagtEALSEEEYARTFPRGMGpkspeLRSEASRESVVVIMNHISLVEMLMDLN- 483
                                   57899**************************************99988********************************. PP

                                   CT-TT-S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-T CS
                         START  71 qWdetla....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppess 140
                                   qW + +     +a+tl+v s+g      galqlm+ae+q++splvp R++ fvRy++q+++g+w++vdvS+d  +      
  Zpz_sc02077.1.g00060.1.am.mk 484 QWWTLFStivsRASTLDVFSTGvagnynGALQLMSAEFQMPSPLVPtRESQFVRYCKQHTDGSWAVVDVSLDGLRGGG-GL 563
                                   88777777777******************************************************************9.8* PP

                                   TSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                         START 141 svvRaellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                                   s++R++++pSg++i++++ng+s+vtwvehv+ +++++h l+rslv+sg+a+ga++w a+lqrqce+
  Zpz_sc02077.1.g00060.1.am.mk 564 SGIRGRRRPSGCIIREMPNGYSRVTWVEHVEADDAMVHDLYRSLVSSGQAFGARRWSAALQRQCER 629
                                   ****************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.97E-19210278IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-22210262IPR009057Homeodomain-like
PROSITE profilePS5007116.73218278IPR001356Homeobox domain
SMARTSM003898.2E-19219282IPR001356Homeobox domain
CDDcd000865.37E-19220279No hitNo description
PfamPF000462.1E-18221276IPR001356Homeobox domain
PROSITE patternPS000270253276IPR017970Homeobox, conserved site
Gene3DG3DSA:1.10.10.604.5E-4263306IPR009057Homeodomain-like
PROSITE profilePS5084840.629395632IPR002913START domain
SuperFamilySSF559615.98E-32398631No hitNo description
CDDcd088751.53E-111399628No hitNo description
SMARTSM002342.6E-62404629IPR002913START domain
PfamPF018521.9E-53405629IPR002913START domain
Gene3DG3DSA:3.30.530.202.6E-5511610IPR023393START-like domain
SuperFamilySSF559612.64E-21655875No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009913Biological Processepidermal cell differentiation
GO:0048497Biological Processmaintenance of floral organ identity
GO:0048825Biological Processcotyledon development
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 901 aa     Download sequence    Send to blast
MAPEEAALVK KLDRRAGWPL PSAIDLPSLW RPAAWARLRQ RARGRVSCNN STPTLNAVSP  60
SPPPCAITPL FNTRTTCPSI SVFPGHSSSS VLVPRPAPIS IAAVPFVSLA HSPSIFCSTQ  120
HLIAIPPSLL IPELPSPLSS IDWLACMPGG MMLPGRNNMP TAAAAAMLGR NGSGLVYSPV  180
TLGGQVNLII ASLCSIQPLD CSVGGELVEV EEDLSLQPLR KKRYHRHTQH QIQELEAFFK  240
QCPHPDDKQR KQLSQDLGLE PLQVKFWFQN KRTQMKTQHE RQENSHLRAE NEKLRAENER  300
YREALANATC PNCGGPATAV IGEMSFDEQH LRLENARLRD EIDRISSIAA KYVGKPAGSL  360
PSSNISSAAT GSLYPPPLSH HLPGLDVLTL PHGAAGIDKP LVIELAVAAM EELVQMAQLG  420
EPLWVPTVID GAGTEALSEE EYARTFPRGM GPKSPELRSE ASRESVVVIM NHISLVEMLM  480
DLNQWWTLFS TIVSRASTLD VFSTGVAGNY NGALQLMSAE FQMPSPLVPT RESQFVRYCK  540
QHTDGSWAVV DVSLDGLRGG GGLSGIRGRR RPSGCIIREM PNGYSRVTWV EHVEADDAMV  600
HDLYRSLVSS GQAFGARRWS AALQRQCERL ASAMSSSVPA APAGGVAAGV VTSAEGRRSM  660
LRLAERMVAS FCVGVTASTT HQWTTLSGSG AEDVRVTTRK SVDDPGRPPG IILNAATSFW  720
LPVPPARIFG FLRDDATRSE WDILSNGGDV QEMAHIANGR DQGNAVSLLR NVNSNQSNML  780
ILQECLTDAT GSYVIYAPVD VVAMNVVLNG GDPDYVALLP SGFAILPDGP GAGQGGSLLT  840
VAFQILVDSV PTAKLSLGSV ATVNSLIACT VERIKAAVAA DNKAGAAPPA KWPIGDQAEA  900
S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972909.10.0PREDICTED: homeobox-leucine zipper protein ROC7-like
SwissprotA3BPF20.0ROC7_ORYSJ; Homeobox-leucine zipper protein ROC7
TrEMBLK3YGB10.0K3YGB1_SETIT; Uncharacterized protein
STRINGSi013279m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.30.0homeodomain GLABROUS 2